PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.9G393200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 323aa    MW: 34791.3 Da    PI: 6.4975
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.9G393200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.94e-171461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        rg W++eEde+l + ++++G g+W+++++  g+ R++k+c++rw +yl
  Sevir.9G393200.1.p 14 RGLWSPEEDEKLMNHIAKYGHGCWSSVPKLAGLERCGKSCRLRWINYL 61
                        788*******************************************97 PP

2Myb_DNA-binding537.9e-1767111147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         rg +++eE++l+++++ +lG++ W+ Ia+ ++ gRt++++k++w++y
  Sevir.9G393200.1.p  67 RGTFSQEEEDLIIHLHSLLGNK-WSQIAAQLP-GRTDNEVKNFWNSY 111
                         899*******************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.9E-27564IPR009057Homeodomain-like
PROSITE profilePS5129419.139961IPR017930Myb domain
SuperFamilySSF466897.11E-3012108IPR009057Homeodomain-like
SMARTSM007173.1E-131363IPR001005SANT/Myb domain
PfamPF002491.2E-151461IPR001005SANT/Myb domain
CDDcd001671.19E-111761No hitNo description
PROSITE profilePS5129426.562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.0E-2665116IPR009057Homeodomain-like
SMARTSM007175.0E-1666114IPR001005SANT/Myb domain
PfamPF002499.4E-1667111IPR001005SANT/Myb domain
CDDcd001674.57E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MAKQSCCHKK KLRRGLWSPE EDEKLMNHIA KYGHGCWSSV PKLAGLERCG KSCRLRWINY  60
LRPDLKRGTF SQEEEDLIIH LHSLLGNKWS QIAAQLPGRT DNEVKNFWNS YIKKRLRERG  120
IDPATHQPLA EPAAAPCRAV FGDVVDLIPP TTTPLQAPLA ADSMPLDGVK LPLDWPVAGT  180
AAPPPSSLSR SSCYHQLQGA CFDMDALQQH CAAAAVPAAP VVPSASSSST LTSMAEAEHC  240
NASVAGADGL PWLELGPNAV ADAGHVDSYA GALDELRWSE YFDAAFQAAA SQQGALQAGQ  300
CVYSGKDDVA VHFDVHGLSN WC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28121165108B-MYB
1h8a_C3e-281211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0365350.0BT036535.2 Zea mays full-length cDNA clone ZM_BFb0120O20 mRNA, complete cds.
GenBankBT0410770.0BT041077.1 Zea mays full-length cDNA clone ZM_BFc0171O14 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004984262.10.0PREDICTED: myb-related protein Zm1-like
TrEMBLK4ACN10.0K4ACN1_SETIT; Uncharacterized protein
STRINGSi036638m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30923385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G57560.12e-76myb domain protein 50